forumku.com logo Forumku Borobudur Budaya Indonesia
forumku  

Go Back   forumku > FJB Pasarku - My Market Place > Jualanku - My Stores and Shops > Health Kesehatan
Register Register
forumku.com kerja sama promosi forumku.com kerja sama promosi Pusat Cutting Sticker 5 December 2012 - 4 Maret 2013
Notices

Post New Thread  Reply
 
Thread Tools Search this Thread Display Modes
Old 19th August 2015, 02:39 PM   #1
Sek Des
 
srimaryati's Avatar
 
Join Date: 22 Oct 2014
Userid: 2722
Posts: 366
Likes: 0
Liked 0 Times in 0 Posts
Post Herbal Untuk Menyembuhkan Wasir

Bagi Anda yang sedang mencari pengobatan tradisional untuk penyakit wasir, kami memiliki solusinya. Jelly gamat gold-g dapat membantu mengobati wasir secara tradisional dan aman. Terbuat dari bahan alami pilihan dan juga telah berstandari BPOM RI menjadikan jelly gamat gold-g dipercaya dan ampuh untuk mengatasi wasir secara alami. Anda bisa mendapatkan jelly gamat gold-g yang asli di tempat kami. Tidak hanya itu, Anda juga bisa menikmati pelayanan terbaik dari kami, yaitu BARANG SAMPAI, BARU BAYAR dan dapatkan promo menarik dari kami berupa potongan harga.





Jelly gamat gold-g merupakan ramuan herbal yang terbuat dari ekstrak teripang asli pilihan, yaitu Golden Stichopus Variegatus yang diolah secara modern dengan menggunakan teknologi terkini yang ramah lingkungan dengan pengawasan langsung dari para ahli, sehingga kualitasnya terjamin. Didalma jelly gamat gold-g ini tekandung zat dan nutrisi yang sangat lengkap yang dapat membantu mengatasi penyakit wasir secara alami dan aman, diantaranya adalah Protein, Kolagen, Mineral, Mukopolisakarida, Glucosaninoglycans (GAGs), Glucosamine dan Chondroitin, Lektin, Saponin, Asam Amino, Antiseptik Alamiah, Omega 3, 6, dan 9, Vitamin dan Mineral, serta Gamapeptide.

Kandungan gamapeptide ini dapat membantu mengatasi peradangan akibat penyakit wasir dan dapat mempercepat penyembuhan luka hingga 3 kali lebih cepat. Anda tidak perlu ragu dan khawatir dengan keamanan dan keasliannya, karena jelly gamat gold-g telah memiliki izin resmi dari BPOM RI dengan no. registrasi BPOM RI TI 114645721 dan juga sertifikat HALAL Malaysia JAKIM (22.00)/192/2/1 010-10/2004.

Untuk pemesanan, silahkan kirimkan sesuai denagn format berikut :


WASAG: Jumlah pesanan: Nama: Alamat Lengkap: No. Hp./tlp.

kirim ke
085.223.944.949 atau Pin BB 53227614


Ingat !! Selalu cantumkan format WASAG dalam setiaap SMS pesanan Anda.

Informasi lengkapnya, klik link berikut http://obatwasir.exl.me/ramuan-herbal-untuk-menyembuhkan-wasir/
srimaryati is offline   Reply With Quote
Old 19th August 2015, 02:49 PM   #2
lilis
Camat Forumku
 
Join Date: 19 Aug 2014
Userid: 2431
Posts: 6,186
Likes: 2
Liked 0 Times in 0 Posts
Default Re: Herbal Untuk Menyembuhkan Wasir

obatkolesterol.utamakansehat.com/obat-alami-penambah-nafsu-makan-untuk-orang-dewasa
obatgondok.utamakansehat.com/obat-tradisional-membunuh-bakteri-dalam-tubuh
obatamandel.utamakansehat.com/cara-mengatasi-asam-lambung-naik-ke-tenggorokan
obatbenjolandipayudara1.utamakansehat.com/ramuan-obat-alami-untuk-menyembuhkan-kencing-manis-kering-dan-basah
obatamandel.utamakansehat.com/obat-stroke-hemoragik
obatgondok.utamakansehat.com/obat-skoliosis
suplementerbaikuntukkesehatanrahim.infonegeri.com
olahragaterbaikuntukorangkegemukan.infonegeri.com
caramenghilangkancairandiotak.infonegeri.com
obatkista1.utamakansehat.com/tips-mengasah-otak
obatbenjolandipayudara1.utamakansehat.com/pil-pelancar-haid
obatamandel.utamakansehat.com/tips-mengembalikan-daya-ingat
obatkelenjartiroid.utamakansehat.com/tips-melancarkan-buang-air-besar
obatgondok.utamakansehat.com/teh-pembersih-flek-paru-paru
obatkolesterol.utamakansehat.com/obat-mata-buram-akibat-diabetes

obatbatuginjal.utamakansehat.com/obat-glaukoma-akut
obatradangsendi1.utamakansehat.com/obat-radang-gusi
obatkista1.utamakansehat.com/obat-tukak-lambung


obatkelenjartiroid.utamakansehat.com/obat-lambung-perih
obatbatuginjal.utamakansehat.com/obat-tulang-keropos
obatkista1.utamakansehat.com/obat-peradangan-dinding-jantung
tipssehatmengatasikegemukan.infonegeri.com


obatgondok.utamakansehat.com/obat-peradangan-ligamen
obatkolesterol.utamakansehat.com/obat-keputihan-berbau
obatkelenjartiroid.utamakansehat.com/obat-penurun-asam-lambung
obatbenjolandipayudara1.utamakansehat.com/obat-stroke-iskemik

obatkolesterol.utamakansehat.com/obat-infeksi-indung-telur
obatkelenjargetahbening.utamakansehat.com/obat-penyakit-mata-katarak
obatbenjolandipayudara1.utamakansehat.com/cara-alami-mengobati-mata-kering

tipssehatmengatasimasalahkewanitaan.infonegeri.com
tipsmengatasipikun.infonegeri.com
tipssehatbagipenderitajantung.infonegeri.com
tipsmerawatkesehatankulitwajah.infonegeri.com
tipsmeningkatkankecerdasananak.infonegeri.com
tipsmerawatkesehatanrahim.infonegeri.com
tipsmerawatkesehatanmata.infonegeri.com
tipsmengatasimasalahkeputihan.infonegeri.com

tipsmengembalikandayaingat.infonegeri.com

pilpelancarhaid.infonegeri.com
tehpembersihflekparuparu.infonegeri.com
vitaminuntukrambutrontok.infonegeri.com
caramembersihkanparuparudariflek.infonegeri.com
gejalaawalterkenadiabetes.infonegeri.com
caralepasdariketergantunganobatdokter.infonegeri.c om
tipssehatmengatasikegemukan.infonegeri.com
obatmataburamakibatdiabetes.infonegeri.com
tipsmenghilangkanflekdiparuparu.infonegeri.com
caramenghilangkancairandiotak.infonegeri.com
tipsmelancarkanbuangairbesar.infonegeri.com
tipsmengempeskanperutbuncit.infonegeri.com
caramengeluarkanbatuempedu.infonegeri.com
carameningkatkankesuburanpria.infonegeri.com
tipsmengasahotak.infonegeri.com
tipsmengencangkanpayudara.infonegeri.com
suplementerbaikuntukkesehatanrahim.infonegeri.com
carameningkatkankecerdasanotak.infonegeri.com
carameningkatkankesuburanrahimwanita.infonegeri.co m
olahragaterbaikuntukorangkegemukan.infonegeri.com


obatkelenjartiroid.utamakansehat.com
obatasamurat.utamakansehat.com
obatkatarak.utamakansehat.com
obatkelenjargetahbening.utamakansehat.com
obatamandel.utamakansehat.com
obatgondok.utamakansehat.com
obatkolesterol.utamakansehat.com
obatbatuginjal.utamakansehat.com
obatkista1.utamakansehat.com
obattbc1.utamakansehat.com
obatradangsendi1.utamakansehat.com
obatbenjolandipayudara1.utamakansehat.com
obatgulabasah.utamakansehat.com
obatinfeksitelinga.utamakansehat.com
lilis is offline   Reply With Quote
Post New Thread  Reply

Bookmarks

Tags
herbal, menyembuhkan, obat, ramuan, wasir



Similar Threads
Thread Thread Starter Forum Replies Last Post
jus herbal untuk atasi wasir jusmanggis22 Health Kesehatan 2 9th February 2015 02:27 PM
Obat Herbal Untuk Wasir notasukardi Health Kesehatan 3 17th January 2015 11:42 AM
obat herbal untuk menyembuhkan wasir tantowijohar01 Health Kesehatan 1 25th December 2014 01:10 PM
obat herbal untuk wasir berdarah tantowijohar01 Health Kesehatan 1 13th December 2014 09:24 AM
ramun herbal untuk wasir berdarah tantowijohar01 Health Kesehatan 5 9th October 2014 02:18 PM


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off

Forum Jump


All times are GMT +7. The time now is 07:25 PM.


forumku.com is supported by and in collaboration with

forumku.com kerja sama promosi kiossticker.com 5 December 2012 - 4 Maret 2013 Web Hosting Indonesia forumku.com kerja sama promosi my-adliya.com forumku.com kerja sama promosi situsku.com

Peserta Kontes SEO Forumku :

kontes SEO: business review

Positive Collaboration :

positive collaboration: yukitabaca.com positive collaboration: smartstore.com positive collaboration: lc-graziani.net positive collaboration: Info Blog

Media Partners and Coverages :

media partner and coverage: kompasiana.com media partner and coverage: wikipedia.org media partner and coverage: youtube.com

forumku.com
A Positive Indonesia(n) Community
Merajut Potensi untuk Satu Indonesia
Synergizing Potentials for Nation Building

Powered by vBulletin® Version 3.8.7
Copyright ©2000 - 2016, vBulletin Solutions, Inc.
Google Find us on Google+

server and hosting funded by:
forumku.com kerja sama webhosting dan server
no new posts