forumku.com logo Forumku Borobudur Budaya Indonesia
forumku  

Go Back   forumku > FJB Pasarku - My Market Place > Jualanku - My Stores and Shops > Health Kesehatan
Register Register
forumku.com kerja sama promosi forumku.com kerja sama promosi Pusat Cutting Sticker 5 December 2012 - 4 Maret 2013
Notices

Post New Thread  Reply
 
Thread Tools Search this Thread Display Modes
Old 31st August 2015, 10:54 AM   #1
Sek Des
 
srimaryati's Avatar
 
Join Date: 22 Oct 2014
Userid: 2722
Posts: 366
Likes: 0
Liked 0 Times in 0 Posts
Post Obat Konstipas Untuk Ibu Hamil

Konstipasi atau sulit buang air besar seringkali dialami oleh ibu hamil. Konsipasi pada saat hamil ini terjadi karena adanya perubahan hormon selaam kehamilan dan tentunya konstipasi ini akan mempengaruhi kinerja organ, termasuk fungsi pencernaan yang cenderung akan melambat.

Tapi, untuk mengatasi konstipasi, tentu ibu hamil tidak disarankan untuk mengonsumsi oba-obatan pencahar atau pelancar buang air besar berdarah secara sembarangan. Karena dikhawatirkan akan berpengaruh pada janin yang ada didalam kandungan. Tapi, ibu tidak perlu khawatir. Karena kami memiliki solsui yang efektif dan juga aman untuk mengatasi konstipasi pada ibu hamil. Kami merekomendasikan Anda jelly gamat gold-g sebagai solusi untuk mengobati konstipasi pada ibu hamil secara alami.




Jelly gamat gold-g merupakan salah satu produk herbal dari PT GNE atau GIT produksi Biogene R & D SDN BHD-Malaysia yang terbuat dari bahan alami pilihan, yaitu ekstrak teripang asli spesies Golden Stichopus Variegatus yang merupakan jenis teripang terbaik dan juga memiliki kandungan nutrisi yang sangat lengkap.

Juga jelly gamat gold-g ini tidak mengandung campuran bahan kimia, jadi aman dikonsumsi oleh semua kalangan, baik anak-anak, orang dewasa, serta ibu hamil dan menyusui. Anda tidak perlu ragu dengan keamanan dan keasliannya, karena jelly gamat gold-g ini telah memiliki izin resmi dari BPOM RI TI 114645721 dan juga telah bersertifikat HALAL Malaysia JAKIM (22.00)/192/2/1 010-10/2004. Kandungan nutrisi lengkap yang ada didalam jelly gamat gold-g ini diantaranya adalah :
  • Protein
  • Kolagen
  • Mineral
  • Mukopolisakarida
  • Glucosaninoglycans (GAGs)
  • Glucosamine dan Chondroitin
  • Lektin
  • Saponin
  • Asam Amino
  • Antiseptik Alamiah
  • Omega 3, 6, dan 9
  • Vitamin dan MineralGamapeptide (Tidak ditemukan pada jenis teripang lain)
Kandungan nutrisi lengkap tersebut dapat membantu mengatasi konstipasi pada ibu hamil secara alami dan juga aman. Kini ibu tidak perlu ragu dan khawatir lagi untuk memilih jelly gamat gold-g sebagai solusi untuk mengatasi konstipasi pada ibu hamil secara efektif dan alami.



Bagi ibu yang ingin merasakan khasiatnya secara langsung, bisa langsung memesannya kepada kami dengan cara mengirimkan format pemesanan berikut :
WASAG: Jumlah pesanan: Nama: Alamat Lengkap: No. Hp./tlp.

kirim ke
085.223.944.949 atau Pin BB 53227614


# Format pemesanan WASAG harus selalu dicantumkan dalam setiap SMS pemesanan Anda.


Informasi selengkapnya, silahkan cek tautan berikut >> Mengobati Konstipasi Pada Ibu Hamil Secara Alami.
srimaryati is offline   Reply With Quote
Old 31st August 2015, 03:18 PM   #2
ramadhanberkah662
Sek. Bupati
 
Join Date: 10 Jul 2014
Userid: 2338
Posts: 11,190
Likes: 0
Liked 0 Times in 0 Posts
Default Re: Obat Konstipas Untuk Ibu Hamil

kesehatanalami.utamakansehat.com/info-lengkap-mengenai-benjolan-di-payudara
tipscararahimwanita.utamakansehat.com/cara-cepat-menyuburkan-rahim-wanita
tipscaramelangsingkantubuh.utamakansehat.com/tips-turun-berat-badan-20-kg-dalam-waktu-singkat
caraalamimengatasi.utamakansehat.com/bahaya-jantung-lemah
obatpenyakittbc.utamakansehat.com/cara-membersihkan-ginjal-yang-kotor
http://caraalamimengatasi.utamakanse...nduan-narkoba/
http://tipscararahimwanita.utamakans...anker-serviks/
http://tipscaramelangsingkantubuh.ut...-secara-alami/
http://caraalamimengatasi.utamakanse...aik-dan-benar/
http://tipscararahimwanita.utamakans...-pada-ovarium/
http://tipscaramelangsingkantubuh.ut...udah-terbukti/
http://caraalamimengatasi.utamakanse...u-pada-remaja/
http://caraalamimengatasi.utamakanse...gemukan-badan/
http://obatususbuntu.utamakansehat.c...tanpa-operasi/
http://obattbckelenjar1.utamakanseha...nyakit-ginjal/
http://tipscaraalami.utamakansehat.c...us-cuci-darah/
obathipertiroid.utamakansehat.com
obatkankerserviks.utamakansehat.com
obatradangpanggul.utamakansehat.com
obatradangtenggorokan.utamakansehat.com
obatwasir.utamakansehat.com
obatdiabetes.utamakansehat.com
obatinsomnia.utamakansehat.com
obatglaukoma.utamakansehat.com
obatnyerisendi.utamakansehat.com
obatnyerihaid.utamakansehat.com
obatususbuntu.utamakansehat.com
obathernia.utamakansehat.com
obatleukimia1.utamakansehat.com
obattbckelenjar1.utamakansehat.com
obatpenyakittbc.utamakansehat.com
obatpenyakitgondokberacun.utamakansehat.com
__________________
ramadhanberkah662 is offline   Reply With Quote
Old 1st September 2015, 12:02 PM   #3
lilis
Camat Forumku
 
Join Date: 19 Aug 2014
Userid: 2431
Posts: 6,186
Likes: 2
Liked 0 Times in 0 Posts
Default Re: Obat Konstipas Untuk Ibu Hamil

tipscarapenyakitparuparu.utamakansehat.com/cara-membersihkan-paru-paru-dari-asap-rokok
obatbenjolandipayudara1.utamakansehat.com/cara-mengatasi-perut-kembung-dan-mual
tipscaramelawanselkanker.utamakansehat.com/info-lengkap-tentang-kanker-serviks
tipskesehatan.utamakansehat.com/cara-mengatasi-penyumbatan-pembuluh-darah-di-jantung
tipsalamimengobati.utamakansehat.com/makanan-penambah-nafsu-makan-anak
obatbenjolandipayudara1.utamakansehat.com/obat-ablasio-retina
tipskesehatan.utamakansehat.com/ciri-ciri-penyakit-mata-rabun-jauh
tipscarapenyakitparuparu.utamakansehat.com/cara-membersihkan-paru-paru-dari-lendir
tipsalamimengobati.utamakansehat.com/cara-mengatasi-sakit-kepala-saat-haid
tipscarapenyakitparuparu.utamakansehat.com/cara-membersihkan-paru-paru-dari-asap-rokok
obatbenjolandipayudara1.utamakansehat.com/cara-mengatasi-perut-kembung-dan-mual
tipscaramelawanselkanker.utamakansehat.com/info-lengkap-tentang-kanker-serviks
tipskesehatan.utamakansehat.com/index.php/2015/08/31/cara-mengatasi-penyumbatan-pembuluh-darah-di-jantung
tipsalamimengobati.utamakansehat.com/makanan-penambah-nafsu-makan-anak
tipsalamimengobati.utamakansehat.com/cara-mengatasi-perut-kembung-dan-begah
tipscarapenyakitparuparu.utamakansehat.com/penyebab-paru-paru-terendam-air
tipscaramelawanselkanker.utamakansehat.com/info-lengkap-kanker-payudara
tipsalamimengobati.utamakansehat.com/cara-terbaik-untuk-menyembuhkan-penyakit-pneumonia
tipscaramelawanselkanker.utamakansehat.com/cara-alami-menghilangkan-benjolan-di-payudara-tanpa-operasi
tipscarapenyakitparuparu.utamakansehat.com/cara-alami-mengatasi-keputihan-abnormal-pada-wanita

tipsalamimengobati.utamakansehat.com/cara-mengatasi-penyumbatan-pembuluh-darah-di-otak-secara-alami
tipsalamimengobati.utamakansehat.com/cara-ampuh-mencegah-dan-melawan-kanker

obatkelenjargetahbening.utamakansehat.com/cara-mengatasi-penyempitan-pembuluh-darah-jantung
obatbenjolandipayudara1.utamakansehat.com/tips-meredakan-nyeri-pinggang
obatbatuginjal.utamakansehat.com/cara-menyembuhkan-amandel-yang-membengkak
obatamandel.utamakansehat.com/cara-memperbaiki-kinerja-ginjal-yang-rusak
obatgondok.utamakansehat.com/cara-mengatasi-susah-buang-air-besar-secara-alami
obatradangsendi1.utamakansehat.com/penyebab-naiknya-asam-lambung-ke-tenggorokan-dan-cara-mengatasinya
obatbatuginjal.utamakansehat.com/cara-mengobati-sakit-persendian-kaki
tipscaraalami.utamakansehat.com/cara-mengeluarkan-gumpalan-darah-di-rahim-setelah-keguguran
obatkatarak.utamakansehat.com/cara-mengeluarkan-cairan-di-kepala
tipscaraalami.utamakansehat.com/cara-mengobati-jantung-terendam-cairan
obatbenjolandipayudara1.utamakansehat.com/cara-menghilangkan-cairan-di-perut
obatkelenjartiroid.utamakansehat.com/bahaya-penyakit-tbc-dan-cara-mengobatinya
tipscaraalami.utamakansehat.com/cara-mengeluarkan-batu-di-ginjal-secara-alami
obatamandel.utamakansehat.com/suplemen-herbal-terbaik-untuk-kesehatan-mata
obatgondok.utamakansehat.com/cara-menyembuhkan-penyakit-tbc-dengan-cepat
obatbenjolandipayudara1.utamakansehat.com/suplemen-terbaik-untuk-kesehatan-tulang-dan-sendi
obatkista1.utamakansehat.com/cara-menghilangkan-penumpukan-cairan-di-paru-paru
tipscaraalami.utamakansehat.com/cara-mengobati-jantung-terendam-cairan
greenworldglobals.com/suplemen-nutrisi-terbaik-bagi-orang-yang-terlalu-kurus
obatkelenjartiroid.utamakansehat.com/cara-mengatasi-asam-lambung-berlebih-naik-dan-tinggi
obatkista1.utamakansehat.com/cara-mengobati-keputihan-abnormal-secara-alami
obatbenjolandipayudara1.utamakansehat.com/suplemen-yang-bagus-untuk-pemeliharaan-jantung
obatbatuginjal.utamakansehat.com/cara-mengobati-penyakit-aritmia-jantung
obatbenjolandipayudara1.utamakansehat.com/cara-menyembuhkan-penyakit-hernia-tanpa-operasi
obatkista1.utamakansehat.com/cara-menyembuhkan-dan-mencegah-penyakit-bronkitis-kronis
greenworldglobals.com/obat-penghancur-benjolan-di-payudara
obatkolesterol.utamakansehat.com/obat-alami-penambah-nafsu-makan-untuk-orang-dewasa
obatgondok.utamakansehat.com/obat-tradisional-membunuh-bakteri-dalam-tubuh
obatamandel.utamakansehat.com/cara-mengatasi-asam-lambung-naik-ke-tenggorokan
obatbenjolandipayudara1.utamakansehat.com/ramuan-obat-alami-untuk-menyembuhkan-kencing-manis-kering-dan-basah
obatamandel.utamakansehat.com/obat-stroke-hemoragik
obatgondok.utamakansehat.com/obat-skoliosis
suplementerbaikuntukkesehatanrahim.infonegeri.com
olahragaterbaikuntukorangkegemukan.infonegeri.com
caramenghilangkancairandiotak.infonegeri.com
obatkista1.utamakansehat.com/tips-mengasah-otak
obatbenjolandipayudara1.utamakansehat.com/pil-pelancar-haid
obatamandel.utamakansehat.com/tips-mengembalikan-daya-ingat
obatkelenjartiroid.utamakansehat.com/tips-melancarkan-buang-air-besar
obatgondok.utamakansehat.com/teh-pembersih-flek-paru-paru
obatkolesterol.utamakansehat.com/obat-mata-buram-akibat-diabetes

obatbatuginjal.utamakansehat.com/obat-glaukoma-akut
obatradangsendi1.utamakansehat.com/obat-radang-gusi
obatkista1.utamakansehat.com/obat-tukak-lambung


obatkelenjartiroid.utamakansehat.com/obat-lambung-perih
obatbatuginjal.utamakansehat.com/obat-tulang-keropos
obatkista1.utamakansehat.com/obat-peradangan-dinding-jantung
tipssehatmengatasikegemukan.infonegeri.com


obatgondok.utamakansehat.com/obat-peradangan-ligamen
obatkolesterol.utamakansehat.com/obat-keputihan-berbau
obatkelenjartiroid.utamakansehat.com/obat-penurun-asam-lambung
obatbenjolandipayudara1.utamakansehat.com/obat-stroke-iskemik

obatkolesterol.utamakansehat.com/obat-infeksi-indung-telur
obatkelenjargetahbening.utamakansehat.com/obat-penyakit-mata-katarak
obatbenjolandipayudara1.utamakansehat.com/cara-alami-mengobati-mata-kering

tipssehatmengatasimasalahkewanitaan.infonegeri.com
tipsmengatasipikun.infonegeri.com
tipssehatbagipenderitajantung.infonegeri.com
tipsmerawatkesehatankulitwajah.infonegeri.com
tipsmeningkatkankecerdasananak.infonegeri.com
tipsmerawatkesehatanrahim.infonegeri.com
tipsmerawatkesehatanmata.infonegeri.com
tipsmengatasimasalahkeputihan.infonegeri.com

tipsmengembalikandayaingat.infonegeri.com

pilpelancarhaid.infonegeri.com
tehpembersihflekparuparu.infonegeri.com
vitaminuntukrambutrontok.infonegeri.com
caramembersihkanparuparudariflek.infonegeri.com
gejalaawalterkenadiabetes.infonegeri.com
caralepasdariketergantunganobatdokter.infonegeri.c om
tipssehatmengatasikegemukan.infonegeri.com
obatmataburamakibatdiabetes.infonegeri.com
tipsmenghilangkanflekdiparuparu.infonegeri.com
caramenghilangkancairandiotak.infonegeri.com
tipsmelancarkanbuangairbesar.infonegeri.com
tipsmengempeskanperutbuncit.infonegeri.com
caramengeluarkanbatuempedu.infonegeri.com
carameningkatkankesuburanpria.infonegeri.com
tipsmengasahotak.infonegeri.com
tipsmengencangkanpayudara.infonegeri.com
suplementerbaikuntukkesehatanrahim.infonegeri.com
carameningkatkankecerdasanotak.infonegeri.com
carameningkatkankesuburanrahimwanita.infonegeri.co m
olahragaterbaikuntukorangkegemukan.infonegeri.com


obatkelenjartiroid.utamakansehat.com
obatasamurat.utamakansehat.com
obatkatarak.utamakansehat.com
obatkelenjargetahbening.utamakansehat.com
obatamandel.utamakansehat.com
obatgondok.utamakansehat.com
obatkolesterol.utamakansehat.com
obatbatuginjal.utamakansehat.com
obatkista1.utamakansehat.com
obattbc1.utamakansehat.com
obatradangsendi1.utamakansehat.com
obatbenjolandipayudara1.utamakansehat.com
obatgulabasah.utamakansehat.com
obatinfeksitelinga.utamakansehat.com
lilis is offline   Reply With Quote
Old 1st September 2015, 12:06 PM   #4
ramadhanberkah662
Sek. Bupati
 
Join Date: 10 Jul 2014
Userid: 2338
Posts: 11,190
Likes: 0
Liked 0 Times in 0 Posts
Default Re: Obat Konstipas Untuk Ibu Hamil

obatglaukoma.utamakansehat.com/cara-mengatasi-perut-kembung-dan-begah
obatnyerisendi.utamakansehat.com/cara-menurunkan-mata-minus-tinggi
kesehatanalami.utamakansehat.com/tips-agar-anak-cerdas-sejak-dalam-kandungan
caraalamimengatasi.utamakansehat.com/cara-mencegah-stroke-berulang
kesehatanalami.utamakansehat.com/info-lengkap-mengenai-benjolan-di-payudara
tipscararahimwanita.utamakansehat.com/cara-cepat-menyuburkan-rahim-wanita
tipscaramelangsingkantubuh.utamakansehat.com/tips-turun-berat-badan-20-kg-dalam-waktu-singkat
caraalamimengatasi.utamakansehat.com/bahaya-jantung-lemah
obatpenyakittbc.utamakansehat.com/cara-membersihkan-ginjal-yang-kotor
http://caraalamimengatasi.utamakanse...nduan-narkoba/
http://tipscararahimwanita.utamakans...anker-serviks/
http://tipscaramelangsingkantubuh.ut...-secara-alami/
http://caraalamimengatasi.utamakanse...aik-dan-benar/
http://tipscararahimwanita.utamakans...-pada-ovarium/
http://tipscaramelangsingkantubuh.ut...udah-terbukti/
http://caraalamimengatasi.utamakanse...u-pada-remaja/
http://caraalamimengatasi.utamakanse...gemukan-badan/
http://obatususbuntu.utamakansehat.c...tanpa-operasi/
http://obattbckelenjar1.utamakanseha...nyakit-ginjal/
http://tipscaraalami.utamakansehat.c...us-cuci-darah/
infonegeri.com/makanan-terbaik-untuk-penderita-diabetes
obatinsomnia.utamakansehat.com/obat-abses-paru
obathipertiroid.utamakansehat.com/obat-flu-tulang
obatpenyakittbc.utamakansehat.com/pengobatan-herbal-untuk-penyakit-mata
obathipertiroid.utamakansehat.com/tips-merawat-kesehatan-miss-v
obatpenyakittbc.utamakansehat.com/obat-untuk-menambah-nafsu-makan
obatpenyakitparuparubasah.utamakansehat.com/obat-biduran
obatpenyakittbc.utamakansehat.com/obat-buang-air-besar-berdarah
obatpenyakittbc.utamakansehat.com/solusi-herbal-untuk-penderita-asma
infonegeri.com/pencegahan-asam-urat-dan-pengobatannya
http://infonegeri.com/solusi-untuk-m...haya-komputer/
obatpenyakittbc.utamakansehat.com/solusi-terbaik-untuk-nyeri-sendi-dan-tulang-rawan
http://tipscaraalami.utamakansehat.c...-secara-alami/
http://tipscaraalami.utamakansehat.c...ami-keputihan/
http://tipscaraalami.utamakansehat.c...-secara-alami/
obatpenyakitparuparubasah.utamakansehat.com
obatpenyakittbc.utamakansehat.com
obatdarahtinggi.greenworldglobals.com
obattbckelenjar1.utamakansehat.com
obatleukimia1.utamakansehat.com
obatkeputihan.utamakansehat.com
obathernia.utamakansehat.com
obatususbuntu.utamakansehat.com
obatnyerihaid.utamakansehat.com
obatnyerisendi.utamakansehat.com
obatglaukoma.utamakansehat.com
obatinsomnia.utamakansehat.com
obatradangtenggorokan.utamakansehat.com
obatkankerserviks.utamakansehat.com
obatstroke.utamakansehat.com
obathipertiroid.utamakansehat.com
__________________
ramadhanberkah662 is offline   Reply With Quote
Post New Thread  Reply

Bookmarks

Tags
ibu hamil, jelly gamat gold-g, konstipasi, obat



Similar Threads
Thread Thread Starter Forum Replies Last Post
Obat Flu Untuk Ibu Hamil ilyasherbal Health Kesehatan 0 11th June 2015 02:09 PM
Obat Maag Untuk Ibu Hamil hanifmaulana09 Health Kesehatan 0 28th May 2015 03:29 PM
Obat Batuk Untuk Ibu Hamil rantisinta Health Kesehatan 6 10th December 2014 01:01 PM
Obat vertigo untuk ibu hamil agoes90 Health Kesehatan 10 5th December 2014 01:26 PM
obat maagh untuk ibu hamil gerisman Health Kesehatan 0 10th September 2014 04:36 PM


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off

Forum Jump


All times are GMT +7. The time now is 05:11 AM.


forumku.com is supported by and in collaboration with

forumku.com kerja sama promosi kiossticker.com 5 December 2012 - 4 Maret 2013 Web Hosting Indonesia forumku.com kerja sama promosi my-adliya.com forumku.com kerja sama promosi situsku.com

Peserta Kontes SEO Forumku :

kontes SEO: business review

Positive Collaboration :

positive collaboration: yukitabaca.com positive collaboration: smartstore.com positive collaboration: lc-graziani.net positive collaboration: Info Blog

Media Partners and Coverages :

media partner and coverage: kompasiana.com media partner and coverage: wikipedia.org media partner and coverage: youtube.com

forumku.com
A Positive Indonesia(n) Community
Merajut Potensi untuk Satu Indonesia
Synergizing Potentials for Nation Building

Powered by vBulletin® Version 3.8.7
Copyright ©2000 - 2016, vBulletin Solutions, Inc.
Google Find us on Google+

server and hosting funded by:
forumku.com kerja sama webhosting dan server
no new posts